PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01014093001
Common NameVIT_19s0014g00310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 79aa    MW: 9168.73 Da    PI: 10.8531
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01014093001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF732.5e-23958251
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       +ien+++rq+tfskR+  ++ KA+E+S+LCd++va++ +s++g+l  +++
  GSVIVT01014093001  9 KIENTTRRQITFSKRKSSLIRKANEISILCDVDVALLTYSPSGRLNKFCN 58
                       69*********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-25159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.661160IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-20222IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-25377IPR002100Transcription factor, MADS-box
PfamPF003191.6E-21956IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-202237IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-203758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MGRKIEMRKI ENTTRRQITF SKRKSSLIRK ANEISILCDV DVALLTYSPS GRLNKFCNRD  60
RMEDVIKSYI NLSPAKRY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4277822e-90AM427782.1 Vitis vinifera contig VV78X192676.7, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015159179.17e-31PREDICTED: agamous-like MADS-box protein AGL104
RefseqXP_009630259.12e-30PREDICTED: MADS-box transcription factor ANR1-like
RefseqXP_007048034.14e-30Uncharacterized protein isoform 2
RefseqXP_007048033.14e-30Uncharacterized protein isoform 1
SwissprotQ1PFC25e-26AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLE0CS087e-51E0CS08_VITVI; Putative uncharacterized protein
STRINGVIT_19s0014g00310.t012e-50(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.13e-27AGAMOUS-like 66